SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LS74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LS74
Domain Number 1 Region: 180-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-16
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LS74
Sequence length 236
Comment (tr|H2LS74|H2LS74_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000008935} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MSSVQSLREFISERLTAAAEEIFRQFEKTIVQYEEEIMDRQHRLLDNCSSWKRNTNNIAD
IPAFICKEFVVNPLSLNHQKGPEEPELKWIKEEQPQLGCSQDWKQLGSETEVDLSAQMFS
GSEIEPKAAQLHFLDSLLIESQGPDLESAKNLEIKEEMSTYGESSSSSSFCLNDTSSNKS
VNCEICGKTLKDKYSMKQHLRIHSGVRPYICRTCGKGFTQKGNLLSHVRIHAGEKL
Download sequence
Identical sequences H2LS74
ENSORLP00000008935 8090.ENSORLP00000008935 ENSORLP00000008935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]