SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LSC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LSC2
Domain Number 1 Region: 967-1015
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000806
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  H2LSC2
Domain Number - Region: 341-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00027
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Domain Number - Region: 735-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000778
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LSC2
Sequence length 1030
Comment (tr|H2LSC2|H2LSC2_ORYLA) Basonuclin 2 {ECO:0000313|Ensembl:ENSORLP00000008983} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
LQAIRCTLVNCTCECFQPGKIHLRTCDQCKHGWVAHALDKLSTQHLYHPTQVEIVQSNVV
FDISSLMLYGTQAVPVRLKILLDRLFSVLKQEEVLHILHGLGWTLRDYVRGYILQDAAGK
VLDRWTIMSREEEIITLQQFLRFGETKSIVELMAIQEKEGQAVTVPSSKTDSGIRTFIES
NNRTRSPGLSSIHIENSSPSSIHHFENIPNSLAFLLPFQYINPVSAPMLGLPPNGLSLEQ
SSMRLREPSLPNQGEQVETSESEVSLSPFRTGQSPSRGVLGAMNNNTEPKKEPSNCGSPI
SPSPSTQQDEPSKTISHSTFSTKMHHRMRRMGTTSRKGRVCCNSCGKTFYDKGTLKIHYN
AVHLKIKHRCTIEGCNMVFSSLRSRNRHSANPNPRLHMPMLRNNRDKDLIRANSTTGTPV
ISSSKNGGFTLTSPGRPPLGFTTPPVDPLLQSPLPSQLVFPSLKSVQPVQPVPPFYRTLV
SPADLVSSPVSLPTSPIMPTSTNSTALMDQQQQILAAASVASHNINSDPTPKKKPRKSSM
PVKIEKEVIDVADEYEDKDEDDDNSIHHNLNHQTHSPSQDEMSPGLALRGMMRQSEDECR
EGTGSDSRGGASELRCMDSFTSEDQDNERDFENESETSDSKMFYRDELMDAEDKVLDSES
GHETHMRKEVEGNGHSSPPPHHPPIKIKEELNDPSYDMFCMSQYGLYNGGMAAAAAAAAS
MAALHESWHHISSIGYGASPPKFPSSQSPEGDPCSSPDPKICYVCKKSFKSSYSMKLHYK
NVHLKEMHMCTVAGCNAAFPSRRSRDRHSSNINLHRKLLTKELDDIVLDPRLTPLPKDLQ
AELLAKIYGGHHTGLDPLTRLGIGAASLRRHANGFLQGQPDDYMVLDLSTTSSVQSSSSV
HSSHESEEGSDEGILLDDLERAEDRGEGGHQDETGEVREGRGEGLGPSSPFLLSSMGASN
GSSGGILCNICHKMYSNKGTLRVHYKTVHLREMHKCKIPGCNMVFSSVRSRNRHSQNPNL
HKNMPFSTIV
Download sequence
Identical sequences H2LSC2
8090.ENSORLP00000008983 ENSORLP00000008983 ENSORLP00000008983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]