SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LUD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LUD3
Domain Number 1 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-18
Family Classic zinc finger, C2H2 0.002
Further Details:      
 
Domain Number 2 Region: 398-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000275
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 307-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000624
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LUD3
Sequence length 481
Comment (tr|H2LUD3|H2LUD3_ORYLA) GLIS family zinc finger 3 {ECO:0000313|Ensembl:ENSORLP00000009710} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
RSLLSRESLASTTLSLFETQSMFSGKHDWPYGYRVLPPLGSSHCSNQANEGCEQFSLSPG
AAMSGTASTSASLPSYLFAYETGSPRQTGARKRPLSMSPLSDLMGIDFNSIIRTSPTSLV
AYINGPRSSPASYSTVSPIQSDGYGHFLGVRGRCIPQNHPYSFPGSSQIPATQFECGRME
MIEEGSSLESQMANMVVKQQCFPEEIGFLEKTTDSGSQPSNNVLLSLQPEPAALSTVQED
AASLGPPPPYHSHKHVYLSRHHCKAKPPSKDPVTQPTAYPHKHGIGYLPQIPMLEEEEAE
LEDYSAHCCRWMDCSAVYDHKEELVRHIEKLHVDQRKTEDFTCYWVGCPRNLKPFNARYK
LLIHMRVHSGEKPNKCSFEGCKKAFSRLENLKIHLRSHTGEKPYLCQHPGCHKAFSNSSD
RAKHQRTHLDTKPYACQVPGCAKRYTDPSSLRKHLKSHSTRERQLRKKLQHKDTTPSAIL
T
Download sequence
Identical sequences H2LUD3
ENSORLP00000009710 ENSORLP00000009710 8090.ENSORLP00000009710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]