SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LUW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LUW8
Domain Number 1 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 236-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 39-96
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 95-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.13e-19
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 5 Region: 281-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 1-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.56e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 422-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000338
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 8 Region: 198-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000778
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 395-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000133
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  H2LUW8
Domain Number - Region: 355-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00525
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LUW8
Sequence length 499
Comment (tr|H2LUW8|H2LUW8_ORYLA) Zinc finger protein 668 {ECO:0000313|Ensembl:ENSORLP00000009896} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
RPFQCPDCHKAYKTATELRNHSRSHTGEKPFVCTECGKAFMQAICLRIHMTQHSGERPYS
CRQCSKSYPTLSKLKVHERSHTGEKPYFCAECGKSFADPSVFRKHRRNHQGHRPYACDEC
GKTYTELKDLKNHERSHTGEKPFLCSDCGKAFSRSSSLACHQRIHSQNKPYQCEQCGKGF
TQLSSYQSHLRTHSGEKPFLCPQCGKMFSDPSSFRRHQRAHSGFKPYPCDKCSKRFRQPA
DLAVHERVHSGERPYKCQSCDKAFVASWDLRRHMLVHTGLRPFSCTECDKSFAERSSLNK
HRRVHSGERPFKCEECLKSFVVSSSLRKHERTHLAEQSAEAASTSNFTTATTLPQFSCNH
CDATFGTWDEVQTHENLHSVDSTSLSVTKIVSLGSHVCATCHAEFAQLADMQEHEKQHPK
PRPHVCNSCGKGFLNKSGLRKHQKIHSTSKPHSCPHCGKAFLFAAYLRKHLRTHSNATQP
ASQLTELNIIHTDPLPSPP
Download sequence
Identical sequences H2LUW8
ENSORLP00000009896 8090.ENSORLP00000009896 ENSORLP00000009896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]