SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LVM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LVM0
Domain Number 1 Region: 152-299,340-355,458-501
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.47e-49
Family Hemopexin-like domain 0.00059
Further Details:      
 
Domain Number 2 Region: 21-61
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000314
Family Somatomedin B domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2LVM0
Sequence length 510
Comment (tr|H2LVM0|H2LVM0_ORYLA) Vitronectin a {ECO:0000313|Ensembl:ENSORLP00000010153} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MKLWDVLLPALLIGAFAEDAQESCLDRCENGFDSQRKCQCDSMCTYYKSCCFDFEAICGM
MTRGDTFDFAEDEDYVFESTTPAAERPSDSNHSPHQRPEATLHMTRSSRLINEKVTRSPN
TDNVAITTKAPGTNATTETSTVPSKTATTQAPDPDAEVCSGRPFDSFMQLKNGSIYAFRG
EYFFELNQRSVLPGYPKLIKDVWGISGPIDAAFTRINCQGKTYIFKGNKYWRFDNGVLDD
DYPRDISVGFDKIPDHVDAAFALPAPHHHGKEKVYFFKGDQYYMYEFLHQPSHEECAIIS
EHSPSTLFRRYTDMYYNNFERYFSELFSDLPQHHDKHHFINKDWKGLKSPVDAAMAGRIY
VTPRGLIPRRYNYQPDQQWGRQQGQQWGRQYQQNGWQWGRRRSNRSPNWGSMSERGINMG
QGFAERGMEDWDQDRRRDVYNQNNRGNYDSRDDRFFRTDMPIQNVYFFKGDKYFRVDLST
KRVDPAMPPYPRSIAKYWLGCSDTPELERK
Download sequence
Identical sequences H2LVM0
8090.ENSORLP00000010153 ENSORLP00000010153 ENSORLP00000010153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]