SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LY26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LY26
Domain Number 1 Region: 935-1062
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-21
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2LY26
Sequence length 1076
Comment (tr|H2LY26|H2LY26_ORYLA) Anillin actin binding protein {ECO:0000313|Ensembl:ENSORLP00000011038} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=ANLN OC=Oryziinae; Oryzias.
Sequence
MDPFTEKLLERTRARRENLQKKLAERPTAASRQMVKRPREPLTDTNSIISDAVPEKVVQA
FSKPSPSKRRYSEENAQPSANEENREPVVPRAGAPELPDPPTDKKPPLGPAGVRYSLEKA
AARPAATVSVQQRMEEAAAPSGGMKSRLQKLAEQRKCWDGIAQEDCTPVLLLKRDAEVSS
PAAPASSSEMAVGRRGRLANLAATIGSWEDDLSHVNIPREKPAAVNPSKPNAAGNPSKPN
AAGNPSKPNAAGNPSKPNAAGNPSKPDAAGNPSKPNAAGFFSTVKAAASLKTKLTMIDLT
GVSTAGPALMVSPPASASSPLKHVSKSVEKKSLNTYTPQKPELHDKPSFSSSTAQQKKVP
AGTPGVKSFLERFGEKCQERVLQTTPARVPLQPRAPAGPPSTSPNTRLLQEKLMAAQSAS
TATADLTMRQKLERESELAQIRSRFQKGNSICKSEKETETSIKRQPAVKSSLHVAGPALM
VSPPASASSPLKHVSKSVEKKSDETPEEEEEVIKETEMNVDQSINSAVINELFDGVLEQS
DDRDEEEEEEDALNISSMSLFIPLTETVTSVVKSPEGKTSTPANSFLVKNNPPENLSKPS
KFQRGGAKPTASSGCADPSDEDLKLPYSIDAYRSTRVKEAERPHVKQVIVRKEDVTERAD
EPRGSTAFSIRQKMKILTSEMNLQQTVIHQASQALNCCTDEEHGKGSQVEAEAERLLLVA
TEKREALKAELERLKGDPTGQKKASGAPEPSLMSASKGSITLQELRLPLKADFVCSTANR
PESTKHSFFILIRAGAEDSVATPLASTHRGLSGDTLTFPTKFSISDVSSDFHIQLQVYCL
VQKHEVCSEKKKKPSKSKAITPKRWNLLRTRITDRFVSAVMASPGGPNAVRTSNFVMVGS
HTLTLSSIGKNKFPLEKVSFLCPLEGHVYLKLHCEVGSKVEEKGFLTMFEDVSGFGAWHR
RWCVLSGYCISYWTYPDDEKRKNPIGRINLTSCTSKKVEPANREFCARPNTFELVTVRPQ
REGDKETLVSQCTDALCVTTNWLSADTKEERNLWMKKLNHILLDLRTWQPDACHGP
Download sequence
Identical sequences H2LY26
8090.ENSORLP00000011038 ENSORLP00000011038 ENSORLP00000011038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]