SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2LYE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2LYE2
Domain Number 1 Region: 23-73
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000196
Family SMI1/KNR4-like 0.021
Further Details:      
 
Domain Number 2 Region: 39-201
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000628
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2LYE2
Sequence length 290
Comment (tr|H2LYE2|H2LYE2_ORYLA) Tubulin polyglutamylase complex subunit 2 {ECO:0000313|Ensembl:ENSORLP00000011157} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=tpgs2 OC=Oryziinae; Oryzias.
Sequence
MEETKENVAYKGVVERLTLGITRILESMPGVVDVRFAERDPADKRSLLSWEQKNSCILPE
DLRDFYLTTDGFTLTWSVKLDNECVPLGCMVINSVTRLCSLLQPVSVFSLPNAPSLADLD
WEDGSTERGLDHAPTAPHFDARSRIFELDSCGGNGKVCLVYKNCTQGVVAQQSEIWFLDR
SLYWHFLTPTFTAYYRLMITHLGLPEWHYAFTPYGPSPQAKQWASLYQPLTFNCDNSSAD
STGDYFRNKLDPTLAFKGKAKTPTPKKKQSAQCSSAKVQGNAGKPSGAKR
Download sequence
Identical sequences H2LYE2
XP_004068925.1.28442 ENSORLP00000011157 ENSORLP00000011157 8090.ENSORLP00000011157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]