SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2M0P7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2M0P7
Domain Number 1 Region: 1062-1083,1119-1146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000756
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 2 Region: 779-831
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000403
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 887-937
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000043
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  H2M0P7
Domain Number - Region: 717-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00153
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number - Region: 502-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00512
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 670-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0199
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2M0P7
Sequence length 1159
Comment (tr|H2M0P7|H2M0P7_ORYLA) Zinc finger protein 687a {ECO:0000313|Ensembl:ENSORLP00000011973} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MGDMKTPDFDDLLAAFDIPDINAQEAIQSNPEEQREEARANAPPNPVNRSQQQTSAAADS
LRPLLYSQSSKHVDVLLPPPLLQSHARRPQESQPSSTLAQNGNMNAEVRRVMDTDEEDSE
PDIGSPLVIQEGPEFVTSPPVNNKQKLHPDLFGNPGNTSSLVPNPPNHGKDGTPTSPNSS
TSDPHAQKAHHSPSPTSTNSTVVQENLYPEHVIDERDSPESPPPSETGCLFTNQSSSWDV
AAPPGSTSSYKDSPHQQELKEVESSQEEKPGRTSKKMAGDGEEPNKENCSADTKDTASSC
ETEMASFPLRPLKVKIKMPTGSITRTVTSGASKRSVKVSTKGVDNSKSSQDGLGARSKKE
LVLQSEMAEKLQETSLIKEESSVETKTKVSATAVSITKSAALPSVSSARVSTGAFNLRSL
GQKTLNTGMTLTSTLPVLPTQPSGRPASIVNSTGAIISKNQSNLVEAFNKILNNKNLLPT
YKPELSSPLPAEWGISLPAQGYRCLECGDAFALEQSLAQHYDRRSLRIEVTCNHCAKRLA
FFNKCSLLLHAREHKEKGLIMQCSHLVMKPVPVDLMISQSDGAREGVCSPTLFPFTLLGS
LPSVLGQATSKLLPSAGKGAEAAPNASTKCPECHTQFCSKEELSDHFQEVKPAHSTSCTE
CSPTMLLPNYCSSVAHQRIHQGSQPHVCPECGLTLKQPLFQKHLYETCLHFSRRVGYRCS
SCLVVFGGLNSVKSHIQQAHCDVFHKCPSCPMAFKSAPSVQSHITAQHPDATEGQTLLIY
KCVMCDTVFTYKHVLHTHFDTHLTNQRVQVFKCPECNKLFSQRHSMLDHFKICFSQTHKT
LTVKEELLSPASTCIPVSFKSSEGGGDLEKGKKRKAKTERIKAPAGWKCQSCNLQFTEKE
DYVNHMSQQHGKTLKKFPCNKCESSFTTTSSMRRHIRDKHKILSRGFRCQFCLESKKTFS
SRAMLERHIELRHGVDRLNQDAGTRGYEADSSSEQDSVRSRRKRREVKLERSEEPTCRMS
PAKKLRSSSSSFPCAPSEDNQAAFQEHISQHRQSAAESAGVQCLQCGACFTSSSSLSRHR
FISHKVKDASGDGPQSLGGNLAPSPSNTKNPSDKSQGKEEEGGLACKVCGKHFEKTSDLN
THFRTHGMAFIIARNAGKT
Download sequence
Identical sequences H2M0P7
ENSORLP00000011973 8090.ENSORLP00000011973 ENSORLP00000011973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]