SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2M2J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2M2J6
Domain Number 1 Region: 1218-1334
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-26
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 
Domain Number 2 Region: 1028-1204
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.46e-19
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 
Weak hits

Sequence:  H2M2J6
Domain Number - Region: 516-656
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000366
Family CRAL/TRIO domain 0.02
Further Details:      
 
Domain Number - Region: 738-853
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000391
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 667-771
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0272
Family Spectrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2M2J6
Sequence length 1355
Comment (tr|H2M2J6|H2M2J6_ORYLA) Rho guanine nucleotide exchange factor (GEF) 40 {ECO:0000313|Ensembl:ENSORLP00000012641} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
EAMEDCVQGALSSLYPPFESTAPPLLSQVFSVLESTYQQDSLRYLLDYFVPAKHLLHKLQ
QHACSQYLGCLFLHSGWPLCLGEKVVVQLSTLDWRLLRSNDFYLQVVPFSTRCPRLALKC
LAAGGRTVQEILVPESQHPLVFTSEWLHSVNKERVGGGLDTCLVSTSDGVVRLPWKEIVY
PKFIHDPSEEVDLLANKDSPMSKRLPSEGNWTPGPGMKSNPALRRRSSEDGLGRTARQPQ
LDGDYVELLELRGGPDGRVDNRQRYLEMHGISKTKTLPLCRRGKAIKLRRGKAWGHSKEE
VLPPQPLRGVAETGKGRRPCSAHDSDEGNKGSTGSAVPEIRGICFGGPRRPGVGRERDSS
GVTHACSDRRRRRKGKGARGRARSGGRPKQKASKVQGKASPASPPSCSASAKHSNAEKTQ
PEQTELADGEEGGPTTTAEAKHSRRRSRAGLKNLGLGPAESSSILTETETESLCHVQSGT
SCPGPLCGEPCPAEAHPDLQTRVTSKEPVLLRQLDAELLQSGVLQLTGTVDRLGRALVFT
EAGSLKEGFCVEEAAQILACFHRITRPTAREKGLTVLLDSRRFPPSDLCLSALKRFQSMQ
SNFFVCLLSSLLHVESSEYSGSWQVHLVKGTAVLQQYVDKQQLLKELDGDFSHSHSDWLA
FRLRLESLAEHCESALCLLGEAQQELETEPMPDDIKSIDKHRRLMANVLADQRLTELQQR
GGAWLAGLTNCSSGLGNGTTTSQLYDSVDHALHQLVQVSNQRGRNLEALGQLAGLVDKLE
KEIEEVQLQLEDYRDPPLSLSRLSLKQQKFRTFRETVNERLKGQCEHILTDNLSSSRHQS
TRKQQIASLWTFLHFQELHSETLAVLSDLEGWNQLNWAGLSQVQIRLPPIPPSRFQDARS
LAMELGGGPLMDLWTQTVERYQRTVAQVKPRFLQSERTQGQGKPKTPSLPSQWDLLGPDS
ENEPQTCSTLKIGDEKGTAVPDWASGRGGGVLIRGVEVSSKEVVDHTGSPRQHVLLGRAD
RDAGADKGSSAQSKPYLLWCRMLSSERQYVAILKGVEETYLPLLELSDSPASLRGKGELL
FSNWSSLSTFHSQSLLPAMEGALVQSLLQQDCFSKYRDHFLQYSHYIRSKPELDSPLVID
RFAFSPQSKLPQASPLPPLSFPQCLQAPIQRLEQYCEALIELGGLNPASDSALSVLRHAQ
RHGEDLRASDLIIGCPIPVAERGELVRQGELTACGGVRRKRAGVRNVFLYQNILIFTKQK
SPTAGHSTYSYKHSIKTGEMGLTQSVGDDGLKFEVWVRQAPRSKASIILQARDREDRAGW
AHDIAHLLWTHAINNTELCLKESLCMGISSKLLLD
Download sequence
Identical sequences H2M2J6
ENSORLP00000012641 8090.ENSORLP00000012641 ENSORLP00000012641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]