SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2M2Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2M2Z0
Domain Number 1 Region: 411-693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.14e-74
Family Protein kinases, catalytic subunit 0.000000364
Further Details:      
 
Domain Number 2 Region: 251-338
Classification Level Classification E-value
Superfamily Kringle-like 1.52e-34
Family Kringle modules 0.00035
Further Details:      
 
Domain Number 3 Region: 8-98
Classification Level Classification E-value
Superfamily Immunoglobulin 5.34e-22
Family I set domains 0.01
Further Details:      
 
Weak hits

Sequence:  H2M2Z0
Domain Number - Region: 142-224
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00144
Family Frizzled cysteine-rich domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2M2Z0
Sequence length 836
Comment (tr|H2M2Z0|H2M2Z0_ORYLA) Receptor tyrosine kinase-like orphan receptor 1 {ECO:0000313|Ensembl:ENSORLP00000012788} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=ror1 OC=Oryziinae; Oryzias.
Sequence
FIRIDAPMNNITTSLGQTAELLCRVSGNPQPEVRWLKNDAPVVQEPRRVSIRSMPYGSRL
RIRNLDTTDTGYFQCMASNSKGSVSTTGVLFVKFAPHNPNLTFEDDFDEDGFCQPYRGIA
CARFIGNRSIFVDSLQMQGEIETQITAAFTMIGTSNQLSDRCSQFAIPSLCHFAFPTCDR
SSGSDKPRDLCKDECEILENDLCKTEYIIARSNPHILKRLKLPNCEELAASDSPEAANCL
RIGIPMPEPINKNHKCYNSSGVDYRGTVSVTKSGRQCQPWNSQYPHSHTYLAVRYPELNG
GHSYCRNPGNKHEAPWCFTLDEGVRMELCDISICDHNEKASGNMEILYILVPSVAIPLAI
ALLFFFICVCRNNQMSARPPAPRQPKLVRGQNLEISVLNTAYKSKGKAKELPLSAVRFME
ELGECNFGKIYKGHLYLPGMDQAQLVAIKTLKDVSNTKQWADFQQESAVLAELQHPNVVC
LLGVVTQEHPVCMLFEFLPQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAI
QVSAGMEYLASHFYIHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYCIQPKTLLPIR
WMPPEAIAYGKFTTDSDIWSFGVVLWEIFSYGLQPYYGFSNQEVMEMVRKRQLLPCPEDC
PPRFYGLMTECWQEGPARRPRFKDIHTRLRAWEGLSSHASSSTPSGGGGNATTQTTSLSA
SPVSNLSNPRYAAATAAGYLYPAQAIPAPGQMAPITAWTPMAVPQTHQRFIPVNGYPIPP
GYTAFPAHFAPQAPPTRVIQHHLPPPKSRSPSSASGSTSTGHVSGVHSTTGSAHEA
Download sequence
Identical sequences H2M2Z0
ENSORLP00000012788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]