SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2M4L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2M4L3
Domain Number 1 Region: 1091-1260
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.51e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000508
Further Details:      
 
Domain Number 2 Region: 558-761
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-44
Family DBL homology domain (DH-domain) 0.00054
Further Details:      
 
Domain Number 3 Region: 14-80
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 3.14e-32
Family Bcr-Abl oncoprotein oligomerization domain 0.0000318
Further Details:      
 
Domain Number 4 Region: 951-1077
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000624
Family Synaptotagmin-like (S variant) 0.046
Further Details:      
 
Domain Number 5 Region: 776-838
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000407
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2M4L3
Sequence length 1312
Comment (tr|H2M4L3|H2M4L3_ORYLA) Breakpoint cluster region {ECO:0000313|Ensembl:ENSORLP00000013381} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
RDVVGSNGHRKLTMVEPVGFIEAWKAQFPESEPPKMELRSVGGIEQELEKCKASIRRLEQ
EVNKERFRMIYLQTLLAKERKSYDKQRWGFRKTPPLGDGRSKPRPPPARKSASHGDGLEA
AFDIPPQAESSSCEHLDGLSPSKQRCGVTMSPRRPTLPPPDKELPSDPKDKLGMGLGVAA
LRSNFERIKRANSHSAGDVTKGQEKHLPPPPPPPPFYTNMEFHHERGLVRVNDRELSEKI
SSLGSQAMQIERKRSLHSLPGNLATVAGDLRPKPVYRGRSTESTCGYDAEYEDGEPNQRH
SGRANGGKPPPPWQPSEFQAYSSVYVGGVMMGEGGSGDGRGSGAVTMRDHGGGDDHLLTW
PRRSYSPGSFEDAGGGGGYTPDCSSNENLTSSEEDFSSGQSSHISPSPTTAFRRPLREKS
RSPSQNSQNSQHSFDSSSPPTPQSQKRHHRQHGGHVVMSEATIVSVRKTGQIWPPAAHHD
LMSHGRTSHDNSFHGDHLGSFCTPPPYGYDADRAEEQRRHHDILPFIDDSPSSSPHLSSK
SRSSRDTLSSGSLESSKSTECDLEKGLEMRKWVLSGILATEETYLSHLEALLLPMKPLKA
AATTSQPVLTVAQIETIFFKVPELYEIHKDFYDALLPRVQQWSHHQRVGDLFQKLAGQLG
VYRAFLDNYELAVETAEKCCQANAQFSEISENLKVRSPKDCKETAKTSLEALLYKPVDRV
TRSTLVLHDLLKHTPTSHPDHPLLLDALRISQNFLSSINEETTPRRQSMTVKKGENRQLL
KDSFMVELVEGARKLRHVFLFTDLLLCAKLKKQIGGKNQQYDSKWYIPLTELTFQGPEEA
DPLTIPQVPDEELDAIKVKISHLRSEIQKEKVIDFNVLPNSKQSYSFLISSDYERAEWRE
VIKEQHKKCLKATSLTSMELQMLTSSCLKLQTVHHIPLSTNKDEDESSGLYGFLNVIVHS
ASGLKQSLNLYCTLEVDSFGFFSNKAKTRVYRYTTEPKWNEEFEIELEGSQTLRLLCYEK
CYNKTKQNKEDGDGTDRIMGKGQIPLEPQSLQGKDWQRTVIPMNGIEVKLSMKFTSREFS
LKRTPTRKPMGVFGVKISSVTKRERSKVPYIVRQCLEEIERRGMEEVGIYRVSGVATDIQ
ALKTAFDTNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDELYPNFTGGITLSDSVA
KESCMLNLLLSLPEPNLVTFLFLLDHLKRVAEKESVNKMSLHNLATVFGPTLLRPSEKDS
KIPTNPTQPISMGDSWSQEVMAQVQVLLYFLQLETIPTPDSKRQSILFSTEV
Download sequence
Identical sequences H2M4L3
8090.ENSORLP00000013381 ENSORLP00000013381 ENSORLP00000013381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]