SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2M4N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2M4N1
Domain Number 1 Region: 24-82
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-22
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2M4N1
Sequence length 131
Comment (tr|H2M4N1|H2M4N1_ORYLA) Kruppel-like factor 9 {ECO:0000313|Ensembl:ENSORLP00000013400} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
RVVGRQASPEKRHCCPFDGCGKVYGKSSHLKAHLRVHTGERPFKCTWPDCGKKFSRSDEL
TRHFRTHTGEKRFTCPLCDKCFMRSDHLTKHARRHAGFHPSMLQGPSVAKRRRCSVSMSS
SDSGDQSPSGV
Download sequence
Identical sequences H2M4N1
ENSORLP00000013400 ENSORLP00000013400 8090.ENSORLP00000013400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]