SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2M5P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2M5P5
Domain Number 1 Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.67e-16
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Domain Number 2 Region: 287-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000856
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2M5P5
Sequence length 418
Comment (tr|H2M5P5|H2M5P5_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000013777} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=egr3 OC=Oryziinae; Oryzias.
Sequence
MTGKLADKIPLTMSSLINTIPDSLYPEEDIPTSMNIFTNTESINHYSQMNTDNIMDLGMG
SEKATSEIQYGSSFQSSRSGQTVTYLGKFAFDTPPSGGIGGSGWCPDNNIISLVSAGILG
VSPSPGNVTTQTSSSGASMGGQAADMEQVYGPPLPPYSTCSDLYQDQGSFHHSPVSSTAL
AYPGNDYHSTPKASMDGSLFSMIPDYNLFHHQGEVGVMEHKPFQTMDPIRVNPPPITPLE
TIRAFKDKQQMHPCFPGGQQHPPQHHPPPQTLTLKPIRPRKYPNRPSKTPVHERPHACPA
ENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCG
RKFARSDERKRHAKVHLKQKDKKQAEKSSGVAGSHTSPPNSCGGPTQFRASATVTRCQ
Download sequence
Identical sequences H2M5P5
ENSORLP00000013777 ENSORLP00000013777 8090.ENSORLP00000013777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]