SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2M968 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2M968
Domain Number 1 Region: 564-753
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-51
Family DBL homology domain (DH-domain) 0.0000000274
Further Details:      
 
Domain Number 2 Region: 758-896
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-38
Family Pleckstrin-homology domain (PH domain) 0.000000452
Further Details:      
 
Domain Number 3 Region: 261-398
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000777
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 4 Region: 995-1045
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000654
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 5 Region: 86-169
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000353
Family CRAL/TRIO domain 0.0091
Further Details:      
 
Weak hits

Sequence:  H2M968
Domain Number - Region: 404-499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0208
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2M968
Sequence length 1075
Comment (tr|H2M968|H2M968_ORYLA) Mcf.2 cell line derived transforming sequence-like b {ECO:0000313|Ensembl:ENSORLP00000015049} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
DEIMQLDSSPLRAADITTDLKKQFAFLSGGRGDNGSPVIVFPEFPAFSEITDREFHNVLS
YLTSVPSLSSTDVGFILVIDRRQDRWAAVKGTLLRIAGSFPGNLQLVLVLRPTTLLQRTL
SDILFKFNKDDFKMKVPVIMLSSLTELHSYIDRSQLTQELGGTQEYCHEKWISHRTAIEG
FALMVKRTAQALQSFGTELAETELPNEIQATTILLSTHTNKRDKMKEDLLVALGQGSRLL
ESINEPIMHNPDHNMNQDELENLATVQRLLSQLDETERAFDEFWLRHQTKLQQCLQLRHF
EHNYREVRALLDQTSEKLTSFSEVGISPAHADHIFTELTTFEERVCEVLDKALALSREGD
ELIQNSHYDEDSIQPKCCELRALSESTSSSLRAKKDHLLKAIELHHRLDRTSKWVDDGIY
LLASQPVDKCQSHEGAEVALQELERYLDNAGCSQLTDLSSIWTEYEGVLNHQLREQVEKV
YQKQTSMQEMFDKRTVSLKKLAAKQLRPVQPVAPRPEAFIKSPLNSPAHRVQQEINSSDS
DNSCGKGQQQNEDGNSRHASLSEEEENLAVLRRHVMNELLETERVYVEELLCVLQGYASE
MDNPGMSHLIPPSLNNKKEVLFGNMPEIYHFHKRTFLRELEQYTDCPELVGRCFLQRMTD
LQIYEKYCHNKPRSESLWRQCSDCAFFHECQKKLEHKLGLDSYLLKPVQRITKYQLLLKE
MLKYSRGREGADDLQEALTSIVGILKAVNDSMHLIAITGYEGNLSELGKLLMQGSFSVWT
EHKKGHAKVKDLARFKPMQRHIFLHEKALLFCKKREENGEGYEKAPSYSFKQSLSMSAVG
ITENAKGDNKKFEIWCNSREEVYIVQAPTADMKTTWVNEIRKVLTTQLEACREASQQRAP
DPVIQAPPVHSVTDLPPAQITSPNARATPRRSATKVTCPAPLLIGCSSKTLDCSKSWNKP
TLSLDASGENDGYSSAEEPLNSDPEDENTKKLCAGKYTVLVDYEKGGAEELSVRSGDSVE
LVKEGDDGQWFVRNLNSSSEGWIAAANLLTLIEKSKSCQSLTSSGTERHRSECNK
Download sequence
Identical sequences H2M968
ENSORLP00000015049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]