SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2M9G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2M9G5
Domain Number 1 Region: 98-412
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.09e-78
Family Papain-like 0.00000449
Further Details:      
 
Domain Number 2 Region: 72-100
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0000267
Family PMP inhibitors 0.002
Further Details:      
 
Weak hits

Sequence:  H2M9G5
Domain Number - Region: 24-52
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00196
Family Somatomedin B domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2M9G5
Sequence length 424
Comment (tr|H2M9G5|H2M9G5_ORYLA) Tubulointerstitial nephritis antigen-like 1 {ECO:0000313|Ensembl:ENSORLP00000015148} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=tinagl1 OC=Oryziinae; Oryzias.
Sequence
GSYCQRRGGCCPGRDDQCTVPYLDTICYCDLFCNRTVSDCCPDFWGHCLGIQPPFIEQTT
PCVCQRNGNKFYTGQTYKENCNLCTCGSSGHWECEKNACLIEADIIHAVNRGNYGWKAAN
YSQFFGMSLDEGIRYRLGTQRPSRTVMNMNEIQMKMDPQNDHLPRYFNSSEKWPNKIHEP
LDQGNCAASWAFSTAAVASDRISIQSMGHMTPQLSPQNLISCDTRNQGGCAGGRIDGAWW
YLRRRGVVTENCYPYQPPQQAPAEVGRCMMQSRAVGRGKRQATQRCPNTYNYHNDIYQST
PPYKLSSNEKEIMKEIMENGPVQAIMEVHEDFFVYKNGIYKHTDVSSTKPPQYRKHGTHS
VRITGWGEDKDYDGTPRKYWIAANSWGKNWGENGFFRIARGANECEIEAFVIGVWGRISL
EDMH
Download sequence
Identical sequences H2M9G5
ENSORLP00000015148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]