SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MB25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MB25
Domain Number 1 Region: 640-708,940-1278
Classification Level Classification E-value
Superfamily Ras GEF 9.55e-120
Family Ras GEF 0.0000125
Further Details:      
 
Domain Number 2 Region: 222-444
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 23-129
Classification Level Classification E-value
Superfamily PH domain-like 1.9e-19
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 4 Region: 432-587
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000158
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2MB25
Sequence length 1280
Comment (tr|H2MB25|H2MB25_ORYLA) Ras protein specific guanine nucleotide releasing factor 1 {ECO:0000313|Ensembl:ENSORLP00000015742} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=RASGRF1 OC=Oryziinae; Oryzias.
Sequence
MQKGIRLNDGHITYLALLAKKDGTRRGCLSKKSSDNTKWHSKWFALLQNMLFYFENDSSS
RPSGLYLLEGCACDRAPSPKPSLSAKECLEKQYYFTVTFNHDNQKALELRTEDVKDCDEW
VAAITQASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAA
LLKDNIKIQSNPEVPPSEDDTEIKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHAESMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIVEGCEVLLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFTKHLIICTRGSGGKLHITKNGVVSLIDCTLMEEPEGTDDESKERS
GQDTEHLDFKVMVEPKDVQPFTVILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFEEN
SKVTVPQMIKAKEVTTFLLTQSFTIKRSVESMSDTSLYCDDVDIRFSKMMNSCKVLQIRY
ASVERLLERLTDLRFLSIDFLNTFLHSYRVFTSAAVVLDKLITIYKKPISAIPARWGWNS
SLELFFASSQNNKLLYGEPPTSPRASRKFSSPPPLSITKTSSPNRRRKLSLNIPIITGGK
ALDLAALSCSPNGYASMSPFSKTTLDINKLYVSSTMASKIPDEAEPKAEGKAEDAVLNKQ
DLSVREECDEDPSQSDEAEAEMSSPKSPSTPKNVKSKNSVEFSLFNFNNGMVVSSCRELE
NNRSALSAASAFAIATAGANEGTPTKEKYRRMSLASTGFPTDQRNGDKEFVIRRAATNRV
LNVLRHWVSKHSQDFELNSELKMRVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGD
SQATIEEITKMAMEESKTEPFENHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKN
ERTPYIIKTTKHFNDISNRIASEILQWDDVNMRVAVIEKWVAVADICRCLHNYNAVLEIT
SSLNRSSIFRLKKTWLKVSKQTKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMY
LTDLAFIEEGTPNYTEDNLVNFSKMRMISHIIREIRQFQQTAYKIDSQTKVAKYLLDNST
VLDEESLYEASLRIEPKTSS
Download sequence
Identical sequences H2MB25
ENSORLP00000015742 ENSORLP00000015742 8090.ENSORLP00000015742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]