SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MD45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MD45
Domain Number 1 Region: 99-306
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-61
Family DBL homology domain (DH-domain) 0.0000183
Further Details:      
 
Domain Number 2 Region: 291-434
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-32
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2MD45
Sequence length 1355
Comment (tr|H2MD45|H2MD45_ORYLA) Pleckstrin homology and RhoGEF domain containing G1 {ECO:0000313|Ensembl:ENSORLP00000016484} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=PLEKHG1 OC=Oryziinae; Oryzias.
Sequence
SSPDSTERPISYGSTSSSASSRDSHCSLGSRSTLVSSPHCNPVTSDCDSGAIRLELVPAR
QLGCREDDEGEDKQHSGQKATEHSEPEMSPEGGERTVQVQGPKTYVDRVVQEILDTERTY
VQDLRSIVEDYLECISKQSRLALSSQDKSSLFGNIRDIYHFNRDLLHHLEKCNSDPVAIA
ECFVCKSEEFHIYTQYCTNYPRSVAVLTECMRNKALAKFFRERQESLRHALPLGSYLLKP
VQRILKYHLLLHEIANHMEKDTETHEVVQEAIDTMQRVAWHINDMKRKHEHAVRLQEIQS
LLTNWKGPDLIGYGELVLEGTFRLQRAKNERTLFLFDKLLLITKKREETYTYKAHILCCN
LMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRMWILHLKRLILENHPAKIPAKAK
QAILEMDAIHHPGFHYSPDGDKKDSPQTKEGPTPRRGRRKEPLSKLLKNAKHNAVNNDTE
KRARESLVREVSHHPPLLRTQHVTEEPPESPIPSVIVTESDHSVKNIWADHRARRAMFPT
RQRTMQPDDEDEDIYQMFVPTEQSAPEPEPPAERSETSSSPRTARPCSWHVEQVPTVQVD
PPPDSSRVLRRASSVGEKATETRRPEEERADRCNLEVINTESSSNEMSGSSSAEQLTIDD
IENVYDNISYEDLRSMGLIRRDPEEIQKQKETSAITQAETVQSPSSIKEPLNEADSSSES
NRSSAPEVKSYESCELKIVEEDIYDTICFREPPSIELKGMNEGNTSLLSLEQDPKTKTCA
GTLSEESLHLGDSEGPEGSRSFSSSSQPDHCYASSPEIFAKPAQKGDKMSEEVDEIWSDL
ENYIKTNEKKADRLPAAFPVSASELPDLQNEGSTEEESHNSTPASRPLPVPPEPPPGTVK
SIRNRLARLSSGSFRLEDDDLVELPQHSPSQRDSTIRDIHSLFPGELAGLDSPLASSSLL
LGESIDFPLEMMDKTKSRVFLMARQYSQKIKKANQLLRMRSMDPGDSCSRARMEKKQKDL
ADILEEKKQGGAAIGARIAEYSQLYDQVMFKDSAGQAVQTSSTQPIGNSGPSLSLSVTQS
SLDEDWLHSTYSNGELASFVSSSSDGMDDQTSTSPQRRIVSSCSIPSLKTIPSSPSAPTP
QRWSSCLSAPSEKEEHVYSSIKRHPSFNGTSSQPIQCHSTSSLVSQQQETQPGLGCNGLS
MHRTTDRSRSPSLGHTGRQSSLPDQLTLGRSDLTLHDGQQVVVLNRASALSILNATQNYL
ANFKDNGEDDDDYVEIRSEDESEAERNRCNAGSAALPNQNRSLVQSLSLPSTPVRTCDPL
KPLEKYLWSEPQQNQPNIVQSLREKFQCLSSSSFA
Download sequence
Identical sequences H2MD45
8090.ENSORLP00000016484 ENSORLP00000016484 ENSORLP00000016484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]