SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MG43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MG43
Domain Number 1 Region: 114-381
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.93e-82
Family Eukaryotic proteases 0.0000312
Further Details:      
 
Domain Number 2 Region: 17-116
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-26
Family Kringle modules 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MG43
Sequence length 394
Comment (tr|H2MG43|H2MG43_ORYLA) Urokinase type plasminogen activator precursor {ECO:0000313|Ensembl:ENSORLP00000017573} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=plau OC=Oryziinae; Oryzias.
Sequence
CLNGGSSFPSLITGEHLFCVCPEGFAGIHCETEVTNDCYEGVGLYYRGQVSETASGRACA
EWDPETRRRFLSWDLHSGRHNYCRNLHFRRRPWCYVGKNHQLQWEYCEIPRCGFQPAEES
TCGQRTRGRQMKIVGGTVSSVESHPWMAAIFWRSKSEKKVFRCGGSLISACWVLTAAHCF
LDGSRSRARHFSVTLGKSALNESNPDTEQMFKVDKIFTHEGFDNSDGNYNNDIALLKLKP
KRGRCAEESAAVKPVCLPPPAQTLHPGFPCQVSGFGKERHELWYNSQYLREAQVNILADD
VCRREDYYGNMITDNMICAASPNWSQDACKGDSGGPLVCAVAERFFLFGVVSWGDGCAEE
FRPGVYTKVTNYNKWIEEKTGLSAITAGSEFPPK
Download sequence
Identical sequences H2MG43
ENSORLP00000017573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]