SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MGJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MGJ9
Domain Number 1 Region: 25-136
Classification Level Classification E-value
Superfamily PH domain-like 3.87e-34
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000041
Further Details:      
 
Domain Number 2 Region: 224-321
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.62e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 417-476
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000314
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MGJ9
Sequence length 488
Comment (tr|H2MGJ9|H2MGJ9_ORYLA) Wiskott-Aldrich syndrome (eczema-thrombocytopenia) a {ECO:0000313|Ensembl:ENSORLP00000017737} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
RGSKSKTESNRSSLLSQQENEKLEELLGRRCSSMATAVAQLFMALPHSPTMWSMQHTGVV
CFVKDNPQRSYFIRMFDMKVKKMVWEQELYNQIIYSTPRTFFHTFTADDCQVGLNFSDEG
EAEIFQNAVVEKISQRNNRQDKKQRPLPTPDRGSLPPVPPDKAGNHGSFHMATVDIQNPD
IQSSRYRTMPPPPAATAVVINNKKSKKSKKKGPKLSKADIGAPSGFTHVSHVGWDPNNID
PNLLKLFSQAGISEADLKDEKTSQLIYNVIEQSGGIEAVQQEANRAAAAPPPPPHGRQGA
LPPLPGSGSSAPAPPPPRGRSGPLPPLPGQSQRGSPTPNPPPPRGGLPPPPPSSRGGLPP
PPPQAPPSSKQGGGGPPPPPPPPPPPPPQTPIPSDFPPPPPSFDSPQPAQTSAGGEGRGA
LLDQIRLGKSLKKVENSDPAPPAAAEPAPGIVGALMMVMQKRSKVIHSSDESEDEGGDDD
DDDEEWDD
Download sequence
Identical sequences H2MGJ9
8090.ENSORLP00000017737 ENSORLP00000017737 ENSORLP00000017737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]