SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MGR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MGR4
Domain Number 1 Region: 112-228
Classification Level Classification E-value
Superfamily ISP domain 6.42e-30
Family Ring hydroxylating alpha subunit ISP domain 0.014
Further Details:      
 
Domain Number 2 Region: 233-441
Classification Level Classification E-value
Superfamily Bet v1-like 0.000033
Family Ring hydroxylating alpha subunit catalytic domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2MGR4
Sequence length 455
Comment (tr|H2MGR4|H2MGR4_ORYLA) Zgc:92275 {ECO:0000313|Ensembl:ENSORLP00000017805} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=LOC101170113 OC=Oryziinae; Oryzias.
Sequence
PNAEGMMMSWTKAAVVLGVAAAALLTPDGAEPQEPAGGGLRLRLSRSATSRALLCITGGL
SLLALHWLYRLLFCPLVLLRTSDDVGYLPATGRSKAQAANEARRRRKVGQLPPVYPNGWY
RVLDSFMLRKAEVKSVSILGQQLAVFRGEDGKAYVLDAYCPHLGANLAVGGQVSGNCLEC
PFHGWQFNGGDGKCVKIPYSKKVPESAKVRSWISCELNDQILVWFHCDGEEPTWSVPEQE
EISNGSWVYRGRTEHFLSAHIQEVAENAGDVAHLFHLHGPGITSGVDLRYINSKLWEFVR
HDWKVEWEANKPEKHCSEMNLKHSMTLFGCHCSLMDMDVVARQVGPSLVFLDFKHPFLGR
GMMLQSVTPVEPLLQCSTHTIYYQANIPAVVPKFILRGECMQFERDVMIWNNKKYISNPL
LVKEDSTIRKHRLWYKQFYSENSPTLQYQNDALDF
Download sequence
Identical sequences H2MGR4
ENSORLP00000017805 ENSORLP00000017805 8090.ENSORLP00000017805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]