SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MHJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MHJ6
Domain Number 1 Region: 46-165
Classification Level Classification E-value
Superfamily Hormone receptor domain 5.89e-30
Family Hormone receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 124-422
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000101
Family Rhodopsin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2MHJ6
Sequence length 481
Comment (tr|H2MHJ6|H2MHJ6_ORYLA) Calcitonin receptor-like a {ECO:0000313|Ensembl:ENSORLP00000018105} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=calcrl OC=Oryziinae; Oryzias.
Sequence
MAEWKLDRFGWNWMVALVLLSSPTILQVKPSPDVNESQHQPTNVYHDIGVTRNKIVTAQF
ECYQKIMKENTHSRQGIEAMCNRTWDGWLCWDDTAAGVTSEQHCPDYFQDFDPSEMVTKI
CTENGHWFLHPESNRTWTNYTRCNEHTNEGRMTAMNLFYLALIGHGLSLVSLFISLAIFF
HFKRSLSCQRITLHKNLFFSFVLNSVITIIWLTAVANNQELVQRNPTSCKVSMFIHLYLF
GCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLLGWGFPLIPASIHAIARSYYYNDNCW
ISSKTSLLYIIHGPICAALVVNVFFLLNIVRVLITKLKVTHQAESSLYMKAVRATLILVP
LLGIQYVLLPYKPGGRVSSEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWNQYN
IQFGSSIGNHSDALRSASYTASSITEVQGCYSIDGHTEHMNGKSCHDTEHASMLKSDSPF
A
Download sequence
Identical sequences H2MHJ6
ENSORLP00000018105 8090.ENSORLP00000018105 ENSORLP00000018105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]