SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MJM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MJM4
Domain Number 1 Region: 80-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000019
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MJM4
Sequence length 175
Comment (tr|H2MJM4|H2MJM4_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000018873} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
GIASSASSIWKQSPASAKCRHRTTRSETSSANPSGQKPPVSAADLLKENVASGTGGDGVG
GGSGTGATLVAVVKKEPKSKTPFICGYCGKAFRDSYHLRRHESCHTGIKMVSRPKKIQMA
PTMVPLISTVTRENNGNPTYVTTVAGILTTATTSMGSGVMSAAQQQTAPKKPPKP
Download sequence
Identical sequences H2MJM4
ENSORLP00000018873 ENSORLP00000018873 8090.ENSORLP00000018873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]