SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MJN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MJN8
Domain Number 1 Region: 81-299
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-52
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 290-381
Classification Level Classification E-value
Superfamily PH domain-like 0.00000002
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MJN8
Sequence length 386
Comment (tr|H2MJN8|H2MJN8_ORYLA) Neuronal guanine nucleotide exchange factor {ECO:0000313|Ensembl:ENSORLP00000018887} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
CIHTYDLQAVNNYNSSYTFLYQEYRDTSKQQEIEQRRQQENLYPGSKGETEAEASAGTSQ
PTLQLQLRNNTHSLSLWQNLEAVQSSGLLSRLSQNEIRMQEAMFELVTSEASYYKSLEIL
ETHFLRNPRLINTLSQSDTHFLFSNIEEVMEASERFLMDLEHRIEEAILISDVCDIVFHH
AEKHFKVFITYVINQVYQEKTYRRILEENQAFRETMAELEKHSCVRGLSFTSFLILPFQR
ITRLKLLVQNILKTAEEHSERETNAIKAHQQLEQIVQECNEGVRKMSRTEELISIEKTLE
FKTKSVPIISHSRWLLKKGEVQLMCGPKSTKTMRSRKLHQPICLFLFNNLLLITKRSSGD
KFQVLDSCTRAMLRTEDLEDQGQQLA
Download sequence
Identical sequences H2MJN8
ENSORLP00000018887 ENSORLP00000018887 8090.ENSORLP00000018887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]