SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MJZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MJZ7
Domain Number 1 Region: 51-192
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000707
Family Phosphotyrosine-binding domain (PTB) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MJZ7
Sequence length 198
Comment (tr|H2MJZ7|H2MJZ7_ORYLA) Integrin beta 1 binding protein 1 {ECO:0000313|Ensembl:ENSORLP00000019001} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=itgb1bp1 OC=Oryziinae; Oryzias.
Sequence
MFRKVKKRHSSSSSQSSEISTKSKSVDSSFGGLSRSSTVASLDTDSNKSSGNSTSETCAE
FRVKYVGSIENLEFEMSRSLQEPLDLINYIDAAQQDGKLPFVPGDEEMILGVSKYGVKVA
SLDQCDVLHRHPLYLIVRMLCYDDGLGAGKNLLALKTTDAKQEECSIWVYQCSSSEQAQS
ICRVLSTSFDCALVSDKS
Download sequence
Identical sequences H2MJZ7
ENSORLP00000019001 XP_004082307.1.28442 XP_011488631.1.28442 8090.ENSORLP00000019001 ENSORLP00000019001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]