SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MK41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MK41
Domain Number 1 Region: 187-398
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.71e-54
Family Reprolysin-like 0.0018
Further Details:      
 
Domain Number 2 Region: 486-542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000458
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 863-923
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000116
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 815-864
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000379
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MK41
Sequence length 923
Comment (tr|H2MK41|H2MK41_ORYLA) ADAM metallopeptidase with thrombospondin type 1 motif, 15b {ECO:0000313|Ensembl:ENSORLP00000019045} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=adamts15 OC=Oryziinae; Oryzias.
Sequence
RLLLILVHLFLHWRASDCMEVDICVPVRVAHLHHGKHERTDRARDAQVAFKLSVFKQDFF
LHLAPDPTFHALDGPPPARTRPCFYAGHVNADPDSLAALSICGGLRGAFSIDGVEYFIAP
QRGDPQERIHVITRRGSRAHERSRCGVSPDSNLTLSLQKYSHMKELYSNGLRRDFWGSLG
RSRRFASTPRYVEVLVVADESMAKFHGDDLQHYLLTLMSVAARLYKHPSILNPINIVVVG
FMVIHEAHKGPKVSSNAALTLRNFCSWQKKLNKYSDQHPEYWDTAILFTKQDLCGASTCD
TLGMADVGTMCDPKRSCSVIEDDGLPSAFTTAHELGHIFNMPHDNVKACEEVFGKLKDDH
MMSPTLIQINRSRPWSVCSAAIITEFLDRGHGDCLLDQPQKQMALLESLPGSSYSLHRQC
ELAFGPGSKPCPYMQSCSKLWCTGKARGQLVCQTRHFPWADGTSCGPEKVCYRSACVHKN
TTVRVKVDGHWGKWGAFGDCSRSCGGGVQLAKRECNNPAPEHGGKYCYGLRLKYRSCNFS
PCPKTGMGKSFREEQCEAYNGFNLNTSRLGSTVVWVPKYSGISPKDKCKLICRANGTGYF
YVLSPKVVDGTPCSPDTSAICVQGKCIKAGCDGKLESNKKFDKCGMCGGENQGCKKVSGM
FTKPVHGYNFVVTLPVGASNVDVRQRGYRGMVGDENYLAVKNSHGKYLLNGNYVVSAVER
DLLVQGSLLRYSGTSTSVEMLQAVRPLQEPLTVEVLSVGNMTPPRIRYSYYISKESKVEK
TLWKEEKSHKAHNSILVDSNKIETKKQIMARKPASHWISGSWDLCSVSCGNGLQRRLVQC
KSVEGLPAGNCEGAERPAAVRVCGDPCPVWDVGSWSHCSKSCGRGFKRRLVRCMTDNGLN
LPREHCFGKRKPQELDLCNLMPC
Download sequence
Identical sequences H2MK41
ENSORLP00000019045 ENSORLP00000019045 8090.ENSORLP00000019045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]