SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MK48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MK48
Domain Number 1 Region: 209-396
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.4e-45
Family Reprolysin-like 0.004
Further Details:      
 
Domain Number 2 Region: 487-543
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000419
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 851-910
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 798-853
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2MK48
Sequence length 910
Comment (tr|H2MK48|H2MK48_ORYLA) ADAM metallopeptidase with thrombospondin type 1 motif, 15b {ECO:0000313|Ensembl:ENSORLP00000019052} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MLHASTCAVLLLLCFVSAARASSFESEDVVPVRIHARRKRSVELPVFALRAFGEELLLKL
VPDARFMAPSFFIRSIRAGDGGVLNRTQEAGGSLRGCFYSGTVGQDLDSVVAVSLCSGIS
GSFITDGILQHGGLETEDQALTCSWQLFKSRSQATIQTPKCTLSAASASVPLGSQRRSSA
YLRWNQGPCESLLVVSIHLRELTHVCLSLQHYILTLMAVTAQLYKHPSIKNSVNLVVVQM
LVVEDDQVGPQVSSNGGMTLRNFCSWQQLFNSPSQRDPGHYDTAVLFTREDICGQKDCKT
LGVADVGTMCDPKRSCSVIEDNGLQAAFTAAHELGHVLSMPHDDSKTCKRLFGDLGGHYL
MAPLFVSLNKSAPWSPCSALYITEFFDNGHGDCLLDVPETAMPLLQELPGARYSLDQQCQ
QIFGEEFVHCPNSSLSDPCSQLWCQEVGTSQCSTQNGSLAWADGTPCSPDRSCLHGVCMS
TQEVMQPLDGSWGAWGPWQQCSRTCGGGVEFSHRECTDPEPQNGGKYCEGQRVRYQSCNT
LPCANDKGKSFREEQCEKYNSPNYLDHNGFVKQWIPKYAGVSPRDRCKLFCRARGSSEFQ
VFQSRVIDGTTCGPDTTSVCVQGQCVKAGCDQVIGSQKRMDKCGVCGGSGLSCRKITGSY
NKAVYGYSDIVTIPYGATNIDIKQRSHRGIKHDGNYLAVKRENGEFILNGNFSVTTVEQD
IPVLGAVLKYSGSSTSLERIQSFRQLKEPITIQVLATAGDANPPKIKYTFFIPKETMFNK
SKEKKDLYSSLLIESVFDVPTWVPGEWSECSKSCGSGWSRRSVECRDGEGLLSFQCDKDH
RPTDIRPCGDLPCPLWQMGPWSACSQTCGRGERRRSVLCIDYTGKTVDPELCDPNKIPEP
ISGECSTHEC
Download sequence
Identical sequences H2MK48
8090.ENSORLP00000019052 ENSORLP00000019052 ENSORLP00000019052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]