SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MKP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MKP0
Domain Number 1 Region: 368-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000912
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 400-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000191
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  H2MKP0
Domain Number - Region: 353-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00417
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2MKP0
Sequence length 437
Comment (tr|H2MKP0|H2MKP0_ORYLA) Kruppel-like factor 5 like {ECO:0000313|Ensembl:ENSORLP00000019259} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=LOC101157720 OC=Oryziinae; Oryzias.
Sequence
LIVMAASVGLPMNPPLAAEERAVFAQLKPVRMSGADGAEDASVFEDVKPGVLSHPPPPPK
KNPPPLFSLSVFQTALELDKYLPQVASPLLTASTDANDKKYRRESASVVDEYFSEDKPST
PYSLNINLILPNTTHLRTGLYRPNTKTLTPHQIKTEPGLEVPCSMPTTTQALPDFTSVFS
MPPVVNNVYIKPENLDTELHIGPQPPQPQVYHMPITSSADLTMTLSHSSSSAHDSAGGRT
MLNLGGNNYMMAEHQLQQHHAYYQVSPSNVPQHTAPHSLPPSPPNSQPGSPDGHAELLSL
ASQPPPPYQQRLGGAKVAGLTPHALLMTHGQGVLTGPKYNRRNNPELEKRRIHFCDYPGC
TKVYTKSSHLKAHQRTHTGEKPYRCTWENCDWRFARSDELTRHYRKHTGAKPFKCVACSR
CFSRSDHLALHMKRHQN
Download sequence
Identical sequences H2MKP0
ENSORLP00000019259 ENSORLP00000019259 8090.ENSORLP00000019259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]