SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MKU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MKU9
Domain Number 1 Region: 96-140
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000353
Family Hairy Orange domain 0.0058
Further Details:      
 
Domain Number 2 Region: 31-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000122
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MKU9
Sequence length 233
Comment (tr|H2MKU9|H2MKU9_ORYLA) Her13.2 {ECO:0000313|Ensembl:ENSORLP00000019320} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=hes6 OC=Oryziinae; Oryzias.
Sequence
MAPSVQPSSSSSSSSDVCTEDDEPYGIQRADRKVRKPLVEKKRRARINESLQELRTLLAD
ADFNSKMENAEVLEVTVKKVEDILKSRSQEKDALNREASERFAAGYIQCMHEVHTFVTSC
PGIDAAVAAELLNHLLECMPLNEDHLQDVLMDLITDTSACNSSTLASPGGGSLSGCEASA
LSPATSPSSEDSCSDLDEVDGEHHQSSTEVAAGSRGGLSMPTVAYPRFMWRPW
Download sequence
Identical sequences H2MKU9
ENSORLP00000019320 8090.ENSORLP00000019320 ENSORLP00000019320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]