SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2ML21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2ML21
Domain Number 1 Region: 149-217
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000963
Family VWC domain 0.0081
Further Details:      
 
Domain Number 2 Region: 272-348
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000115
Family VWC domain 0.023
Further Details:      
 
Domain Number 3 Region: 624-681
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000311
Family BSTI 0.055
Further Details:      
 
Domain Number 4 Region: 90-157
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000398
Family VWC domain 0.0062
Further Details:      
 
Domain Number 5 Region: 227-281
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000251
Family VWC domain 0.02
Further Details:      
 
Domain Number 6 Region: 44-97
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000272
Family VWC domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2ML21
Sequence length 683
Comment (tr|H2ML21|H2ML21_ORYLA) BMP binding endothelial regulator {ECO:0000313|Ensembl:ENSORLP00000019392} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=bmper OC=Oryziinae; Oryzias.
Sequence
MLFCCSNPLSKSTCKFFICFLWLLQTPLSSFPLITGTEASCENEGEVLHIPNITDNPCIT
CVCLDGKADCKQEKCQPVSEDCALVVKQTGACCERCKGCTLDGRSHNSSESWISSTKPCK
SSRCQEGVITEAEVQCVIHCRNPKTHPKKCCPTCPGCILEGHLYKEMEEFSPEGKPCIKC
TCSGGRTLCMKEVCPVLSCPAYLSHTPAGQCCPTCIGQRKVFDLSLGSCLFHSEVYENGT
SFLHDNCTTCTCKDSTVVCKKSCSRPGSCQGNQCCDPCVSYVKVEEVQYCRVRNKIYREG
DMWSSMNCTLCACVKGSIECRPKKCVPITSCPPNKILNRTGCCPVCTEKPGVCTVFGDPH
YNTFDGRTFNFQGTCQYVLTQDCGGSPSGLENNPDSNFMVLVKNYARRTRHFSWTQSVEV
RLGSVILSLHQHLTVRRNGTRIALPYHGPGVHIDLDGYLLKLTSIAGLEITWDGDSFVEV
VAAPHLRGRLCGLCGNYNGHKRDDTMGGDGQLKFDVDEFAESWRVEGNEVCSQHQPRRPS
SFLCPGSPKVKFRAHRECQRIKSWDFQKCHSVVDFAPFYRSCITDMCECPIHKNCYCESF
IAYSRACEREGVVVQWKPDNVCMATQCKHDAVYDTCGPGCTKTCDNWNEIGPCQKPCVAG
CHCPANLVLFHGRCIKPTACPGR
Download sequence
Identical sequences H2ML21
ENSORLP00000019392 XP_004078510.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]