SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MLX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MLX2
Domain Number 1 Region: 99-351
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.62e-82
Family Eukaryotic proteases 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MLX2
Sequence length 480
Comment (tr|H2MLX2|H2MLX2_ORYLA) Protease, serine, 56 {ECO:0000313|Ensembl:ENSORLP00000019708} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
AFASFSCATVSPSSASSEPSCDVISKAQKLQAEAERSWALSQVCAYYQHRCPPTEVNTES
CIRIMGESCSARVLQCSLLNTMQNLEPATQTQAQGERTMQMLTDYLKMLYLICITSSLAA
ACGRKLSSVQNITQPRSRIVGGSPAPPGSWPWLVNLQLDGALMCGGVLVDSSWVVTAAHC
FAGSRGESSWTAVVGEFDITKTDPDEQVLKVNRIISHPKFNPKTFNNDLALVELTSPVIL
SEHVTPVCLPSAMDPPTGTPCLVAGWGSLYEDGPSADVVMEAKIPLLPQNTCKSALGKEL
VTSTMFCAGYLSGGIDSCQGDSGGPLIYQDLISGRFQLYGITSWGDGCGEKESVGSREPT
CPDLLKTTDMTEEEQRSEFGSLCRFYTLTCPPGQSVSSCTQLAEEKCLNRFKKCQLRSFL
QSLLDLLQRAEDYIRDRVDLTFFTQTLPQLVEHIYNTAFTPSREKRDLRVIPSLTQIKGT
Download sequence
Identical sequences H2MLX2
8090.ENSORLP00000019708 ENSORLP00000019708 ENSORLP00000019708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]