SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MMB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MMB3
Domain Number 1 Region: 453-534
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.68e-29
Family Forkhead DNA-binding domain 0.0000142
Further Details:      
 
Weak hits

Sequence:  H2MMB3
Domain Number - Region: 298-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0143
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MMB3
Sequence length 668
Comment (tr|H2MMB3|H2MMB3_ORYLA) Forkhead box P4 {ECO:0000313|Ensembl:ENSORLP00000019853} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MMVESASETIRTTPSNQNGVSSLSSQSDGGGGREGGSNGDVNGEISPVDLLHLQQQQALQ
AARQFLLQQASGLNSPGSNEVKQSPVQVPVSMAMMSPQMITPQQMQQILSPPQLQALLQQ
QQALMLQQLQEYYKKQQEQLHLQLLTQQQQQQQQQQQQQQQAGKQAAKEQLGSKQLAFQQ
QLIQMQQLQQQHILNLQRQGLVPMQPTAAMQSLQQAMCPSDLQQLWKEVSGVPSSEEALK
QAEGLDLSTNSSNSTSAFPKAANAHIPLHNLPNGQNHTPKRDSHEEHTGSHPLYGHGECK
WPGCEALCEDMGQFIKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLAKESERLQAMMTHL
HMRPSEPKPFNQPVSTSCEAYPEGLPHPPTSAATPITPLRQGPSVISSSSLHTHSHSHTH
PVGPIRRRNSDKYCTPIASELAQNCEFYKNADVRPPFTYASLIRHAILESPDRQLTLNEI
YNWFTRKFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRRPPKMTG
SPTLVKNMISGLGFGSLNASYQAALAESSLSLLNSPSLVTPPSAASLNMLHVGHDDVSST
VEQVNSNGSCSPTLSPQQYSHPVHVKEEPTEVEEDSRPVSLLAGVTHSLPLPSDERDLEE
DLPTEELE
Download sequence
Identical sequences H2MMB3
ENSORLP00000019853 8090.ENSORLP00000019853 ENSORLP00000019853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]