SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MNQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MNQ7
Domain Number 1 Region: 244-484
Classification Level Classification E-value
Superfamily Caspase-like 3.29e-44
Family Caspase catalytic domain 0.00018
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily DEATH domain 3.18e-19
Family DEATH effector domain, DED 0.0078
Further Details:      
 
Weak hits

Sequence:  H2MNQ7
Domain Number - Region: 10-77
Classification Level Classification E-value
Superfamily DEATH domain 0.000447
Family DEATH effector domain, DED 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MNQ7
Sequence length 484
Comment (tr|H2MNQ7|H2MNQ7_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000020363} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
LDHQRNHLYYINKIVEALSSSECRKLLFLCDSTSADSSVQSVRETLKLQVTCHDNASQFL
AEVIWRMGRYDILKELFTLSRNAVEQTLENRQVLSKFRVLMANISEDLDTEDLEQILFLL
STTLPREKRDAKQSFLDVIVELEKLDLVSPERVDMVEECLRNICRIDLAKKVSTYKKTVF
RQNQKKSIISAERQAFIRKLTSECGRDVVLSQTSARMENKDLLLIHNDLNKEILSNSTFF
NGAFQLQHSQLEQYSLNSKPRGLCVIIDCVGFDQGMLEQTFKALHFNVVLHPLLGGKQII
SCLTEILKQEQNLKGDAFVCCIISRGTANHLLGIDSYGMGVSLDHVRQSFTGNACPMLAG
KPKLFFIQTYSLDEGGSCDRIEHRDGDIEIDGCNGPLTSSYIPSEADMFWSHCLTDVSQL
DQGGHHSVYLRTLTAALENARIRKADLVDAHTKVNGAVYEHNSRNPTSVYHISVKHTLRK
SLYL
Download sequence
Identical sequences H2MNQ7
ENSORLP00000020363 ENSORLP00000020363 8090.ENSORLP00000020363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]