SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MSF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MSF4
Domain Number 1 Region: 1287-1451
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-65
Family Pleckstrin-homology domain (PH domain) 0.0000043
Further Details:      
 
Domain Number 2 Region: 1081-1289
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-54
Family DBL homology domain (DH-domain) 0.000000158
Further Details:      
 
Domain Number 3 Region: 469-585
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-19
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 853-950
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000907
Family Interleukin 16 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2MSF4
Sequence length 1694
Comment (tr|H2MSF4|H2MSF4_ORYLA) T-cell lymphoma invasion and metastasis 2a {ECO:0000313|Ensembl:ENSORLP00000021692} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MGNSESQYSIEVPKATSFTFPRKQKPYSLKLRSAKEDVLSPHMWWKNTPIGSRYRSSCGG
RGCLSPPKSYHAAKGTRGSQSEQRSHRSPGCVIRRRHMSDDYDGNPYGAELNGHALNGHS
DEVLEEQSSPRVVIRKDGTLRVEFTNSSGNPLLLDATSGPVQLLKFSPNLETTSTPSLPG
SRGSRQDDHCGGPPPASTSSTARTSKGSSLSSEGSWYDSPWGPSTELCEQEKPCSTSRTL
AHSPIQHGSFAEQPTLVSITDLYKDSAMAATFPTARDLSSQIQESPPGRRPHRASLASVL
DVPFEEECAESPRYLSYTLPCRRPKAHTISFNKKDSLRNRIRRFSDWTGSLSRKKKKLQD
TRYKDTNDAFDSGVDGLTADTSSPSQVSSLLWFPGACRTQSSGALHQTTSDAVRQNIYEN
FMRELETGAGHGGGERRDPSTEDGESSSESAEGSLEQLDLLFEKEQGVVRRAGWLSFKPL
VTLHKDRKLELVTRRRWKQYWVTLKGCTLLFYETYSKGSPEQELSPRYALLAEDSIVQAV
PEHPKRENVFCLSNSYGDVYLFQATNQTDLENWVTAIHSASASLLAKRQGKEDTVRLLRS
QVRSLLQKIDMDGKMKKMAELQLTVVGDPKNRKAIENQIQQWEQNLERFNMDLFRMRCYL
ASLQGGELPNPKSLLAIASRPTKSTLGRLGIFSVSSFHALICSRDEAAVRRRSLSLTCRQ
RKKGLFSSLKGLDNLTKRGRDKRPSVSQIFESDAGGQTYGLPPRSSESMERIYSMSPPEG
GVWNGASGAADTVTRVHMPAGLTLQVPVKAPQTVTDLLHAACKVRQLDEGSYGPQLRRRS
GQDTHPGCLDPAELLGDLVGDQLEVVPTNVFTLNLRRQDTTADFGFAVTGHIDGNKNSRI
LVSEVLPNGLAFSGGLLPGDEILVLNGRCVSSLELSLIQTLFAEQTLHLRVRSAPIKGKK
SVCVMWSEWRVCAHSHSSCAPIGNQAAIREIHKTGFFFNKLSNQLYINVPNVATRALKSQ
RAGLHTSISRLAAVEGVFLLASGINSLLESFQEGSNSRDGAAMDERKDPSARPYPKHMSA
TERLRKVIQELVDTEKSYVKDLDCLFEIYLKPLERETFLTHDEMESLFGSLPEMLDFQRV
FLQTLEERIASSPDFSTLEPCRSLNSYTAEAAVSLGGSFLYYADHFKLYSGFCANHIKVQ
QVLKKAKTDQAFKEFLDARNHTKQHSSTLESYLIKPVQRVLKYPLLLRELVSLTDADSEE
HHHLTEALKAMEKVASHINEMQKIYEDYGSVFDQLVAEQTSHDKEITEISMGEFLVHSSV
VWLNPHPSLGRMRKEPEITVFVFKKAVILVYRETNKLKKKMQTNPRSALCHGEPDPFKFC
WLIPLSALQVRLGNAAGTGAESSCIWELVHSRSEVEGRPETLFQLCSSSPESKAGIVKVI
RSILRENVRRNMKSEGPLEGRCKERLTPLHTTLPSSAKLGSSRASWMCKQRTEEAPGQGA
TLKLGLDSDDGSLSSGTYSISGAPPACASSDSQHCRSSSKARSTSVKESDILSDEDDDGF
IEGGARRSSGESSSPTSAIEAQFLELKLSEKASSKRSPAPCVQPERVGDTPEVEPKLVRG
HFSAVKRKGSGVRRSPQVLLHMKDQHRSLDSQTDPTFSTGVDLNSLLEREFSVQSLTSVV
NEECFYDAAESCTS
Download sequence
Identical sequences H2MSF4
ENSORLP00000021692 ENSORLP00000021692 8090.ENSORLP00000021692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]