SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MSX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MSX7
Domain Number 1 Region: 322-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 355-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000188
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2MSX7
Sequence length 439
Comment (tr|H2MSX7|H2MSX7_ORYLA) Sp9 transcription factor {ECO:0000313|Ensembl:ENSORLP00000021870} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=sp9 OC=Oryziinae; Oryzias.
Sequence
MATSILGEEPRFGTTPLAMLAATCNKIGNTSPLTTLPDSSAFSKGGFHPWKRSSSSCNLG
SSLPGFTVSTSRASTGLTPTSGTGNSAFCLASTSPTSSAFSTEYSGLFSNSASVTTQESG
QSAFISKVHTSAETLYPRVGMAHPYESWYKSGFHSTISGEVANGASSWWDVHTNPGSWLD
VQNPAGTLQTSLHSGTPQAIHSQLSGYNPDFSSLTHSAFSSTGISPSASHLLSTSQHLLT
QDGFKTVIPTYTDASAANAMISGGSSGISSSSRSSRRYSGRATCDCPNCQEAERLGPAGA
SLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLR
THTGEKRFACPVCNKRFMRSDHLSKHIKTHTAGGGGKKGSDSDTDTSNLETPRSESPELI
LEGVNPRISVKDPSPHDEP
Download sequence
Identical sequences H2MSX7
ENSORLP00000021870 8090.ENSORLP00000021870 ENSORLP00000021870 XP_004081809.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]