SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MV45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MV45
Domain Number 1 Region: 357-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000169
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 390-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000569
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2MV45
Sequence length 469
Comment (tr|H2MV45|H2MV45_ORYLA) Kruppel-like factor 11a {ECO:0000313|Ensembl:ENSORLP00000022671} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=LOC101171127 OC=Oryziinae; Oryzias.
Sequence
MFGFAQGRSCQVGGVKGQPVEQKPCVQYHDLEAAEALVSMSFWGQKLLKPRPLTPTSDSG
DSLQLQQEGADAAKDMIALSSLCMTPPHSPSYSEASTRTTSTVGASSGRDVLLCSSPATF
SSPPSDFQTCLTPPRSSPLTSETSPPSPQTQLSCKAMATSVIRHTADSLSPATPGPPTQL
TETSVPPGPDTLPQEKDALPPSPNSNTPPPSAPPPSSTSSCSAAFPSSPVLCQVFPVNGQ
TGMISAFVQAPVQVQAQAGTKPILPQTPPQGFAQPLLVSSAVTQGTVMFVVPQAPISQPQ
QGPQTVMTLGSTKLLPLAPAPVYLPSGPSGAASQADFLRRRNYVCTFPGCRKTYFKSSHL
KAHLRTHTGEKPFSCHWEGCEKKFARSDELSRHRRTHTGEKKFVCSVCDRRFMRSDHLTK
HTRRHMTTKRASSWPAENRELKRSLPKGPSRSPALAVEPNVHTPFVCQS
Download sequence
Identical sequences H2MV45
ENSORLP00000022671 ENSORLP00000022671 8090.ENSORLP00000022671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]