SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MWH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MWH5
Domain Number 1 Region: 96-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-18
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2MWH5
Sequence length 176
Comment (tr|H2MWH5|H2MWH5_ORYLA) Sp6 transcription factor {ECO:0000313|Ensembl:ENSORLP00000023221} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=SP6 OC=Oryziinae; Oryzias.
Sequence
LSPASHSPHLYPQDGFKMEPMASDMLQQEAYSLEEPPETSVSHRPKPQRRSSSRGAGQAV
CRCPNCVHAEQMGQSPDDSRRKHMHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWL
FCGKRFTRSDELQRHLQTHTGAKKFSCALCPRVFMRNDHLAKHMRTHESPPGQGEE
Download sequence
Identical sequences H2MWH5
ENSORLP00000023221 ENSORLP00000023221 8090.ENSORLP00000023221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]