SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MYC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MYC4
Domain Number 1 Region: 78-170
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000246
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2MYC4
Sequence length 170
Comment (tr|H2MYC4|H2MYC4_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000024002} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MGCCSVTQRHTGVDEVGPDEIELLELPGDSLGVWSPGEARLQLSLRNSRDEQQVQPPAPR
SSARLLEPEVVLWGRSREELHHRICSQQPIRGWEGQAAHLYGEVLHSSLVSLWDRHTQET
RELFLVLFPFHLLILALDHSRRDFAYQGILPLSGLSVKAEPDTSYSPHGF
Download sequence
Identical sequences H2MYC4
ENSORLP00000024002 ENSORLP00000024002 8090.ENSORLP00000024002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]