SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MZX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MZX2
Domain Number 1 Region: 90-178
Classification Level Classification E-value
Superfamily Kringle-like 1.21e-27
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily Kringle-like 1.98e-26
Family Kringle modules 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2MZX2
Sequence length 245
Comment (tr|H2MZX2|H2MZX2_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000024648} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
HNYNGNIHITKSGRVCQHWSHSFPHPIFREFNASEPNSILQENFCRNPDKRSEGPWCFTK
DPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSP
QAKALSKDKEFIPEVQLTGNKCRNPDNDPEGPWCYVHISGNITVDYCDLDLCEDPLLAQE
QETETEGRERSVLAPAKKLFFNPRTFGEGESSCGLRPLFELKSKKDAKEQELLDSYREQR
IVGGD
Download sequence
Identical sequences H2MZX2
ENSORLP00000024648 ENSORLP00000024648 8090.ENSORLP00000024648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]