SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2N0Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2N0Q2
Domain Number 1 Region: 85-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000653
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  H2N0Q2
Domain Number - Region: 22-47
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00119
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2N0Q2
Sequence length 401
Comment (tr|H2N0Q2|H2N0Q2_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000024968} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=LOC101167434 OC=Oryziinae; Oryzias.
Sequence
MFHQQNPLKGQLDNSLSTDKEFFYCHSCGKQYNTQIGYRRHLVAFHSTSAGKPCPEDFPD
LLENVNHLGDMPPTPEGSINTPVRERKYSCERCERRFYTRKDVRRHAVVHTGRRDFLCPR
CTQRFGRRDHLTRHLKKSHAQESSLMSQCASDPPLTPAKEESGLLPPDGGAVSKDSLEVF
PRDICSPYPLVSPVPGMGHTHMQGSLSAGMGVGPSQVQHQLQPPSAPQQQSLNNISRYQH
GFTTYPRSDMDSFLLDLQSAPPPQMNAVNSSTSTSPQRETVVGVTAGGDTHLMPCSPNIS
TAELSCSNMELGPLLGFLPFSLPPYSPHMGMGGLVMSYPPAATTSSSSSSSSTVLSGQAP
GTFSFFQPPQAHVPQGPAVHSHSQLPQPSSCLSHYYQAFQQ
Download sequence
Identical sequences H2N0Q2
XP_004086444.1.28442 8090.ENSORLP00000024968 ENSORLP00000024968 ENSORLP00000024968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]