SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2N1X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2N1X4
Domain Number 1 Region: 369-458
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-38
Family Kringle modules 0.0000432
Further Details:      
 
Domain Number 2 Region: 184-270
Classification Level Classification E-value
Superfamily Kringle-like 1.38e-35
Family Kringle modules 0.0000919
Further Details:      
 
Domain Number 3 Region: 273-358
Classification Level Classification E-value
Superfamily Kringle-like 1.81e-34
Family Kringle modules 0.0000773
Further Details:      
 
Domain Number 4 Region: 91-184
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-34
Family Kringle modules 0.0001
Further Details:      
 
Domain Number 5 Region: 464-548
Classification Level Classification E-value
Superfamily Kringle-like 1.75e-30
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 6 Region: 21-101
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 4.71e-18
Family Hairpin loop containing domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2N1X4
Sequence length 548
Comment (tr|H2N1X4|H2N1X4_ORYLA) Plasminogen {ECO:0000313|Ensembl:ENSORLP00000025439} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence
MDFCWKAALLLGAVICSASSSDVEGYSKTEGAWVLSLHRRQYSVNSVTDCAAKCNAETTF
TCKSFAYVEKDQECWTAASNSKTEPVLRRQNSALYEKNDYLLECVNGLGTDYRGTKAKTK
SGKVCQRWEARFPHRPNITPQTHPRADLDSNFCRNPDGDSRGPWCYTTDPETRWEHCNVT
SCGEDCIHCNGEDYRGKASITENGYTCQRWDSQSPHSHGYNPDAIPEKYLEENYCRNPDG
DPRPWCFTTSSSKRWDYCAIPRCTSEPPTIVPELTCASGEGQAYRGTVGVTVTGKACQMW
SDQTPHKHSRTPENYPCKGLDNNYCRNPDHEKMPWCYTTDPETRWEFCRVPRCGDSPDPD
EAVSPPEENNDCYEGNGANYRGVTSETVSGKKCQMWSSMSPHSHDKSPQNFPEAGLRRNF
CRNPDGDRAPWCYTTDPKVRWEYCSLKKCSEPTKSPQPQDTQSPAEKDCKIGNGESYRGP
TSITVSGVTCQGWRDQSPHTHSSFTPQTHPDKGLEGNECRNPDGDSNGPWCYTTDRNKKW
DYCQIPDC
Download sequence
Identical sequences H2N1X4
ENSORLP00000025439 8090.ENSORLP00000025439 ENSORLP00000025439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]