SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2N494 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2N494
Domain Number 1 Region: 152-166,301-539
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-67
Family Nuclear receptor ligand-binding domain 0.00000000273
Further Details:      
 
Domain Number 2 Region: 84-167
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-30
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2N494
Sequence length 541
Comment (tr|H2N494|H2N494_PONAB) Nuclear receptor subfamily 5 group A member 2 {ECO:0000313|Ensembl:ENSPPYP00000000425} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0024164 OC=Catarrhini; Hominidae; Pongo.
Sequence
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A
Download sequence
Identical sequences G3R3Z2 H2N494 H2Q0V0 O00482
ENSP00000356331 IGBMC-1017-000 gi|45545405|ref|NP_995582.1| ENSGGOP00000009977 ENSP00000356331 ENSGGOP00000009977 NP_995582.1.87134 NP_995582.1.92137 XP_001142695.1.37143 XP_003823109.1.60992 XP_004028157.1.27298 9598.ENSPTRP00000003036 9600.ENSPPYP00000000425 9606.ENSP00000356331 ENSPPYP00000000425 ENSP00000236914 ENSPTRP00000003036 ENSPTRP00000003036 ENSPPYP00000000425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]