SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2N5V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2N5V5
Domain Number 1 Region: 1025-1079
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000143
Family Centromere-binding 0.022
Further Details:      
 
Domain Number 2 Region: 561-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000318
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 3 Region: 586-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000774
Family Classic zinc finger, C2H2 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2N5V5
Sequence length 1410
Comment (tr|H2N5V5|H2N5V5_PONAB) Pogo transposable element derived with ZNF domain {ECO:0000313|Ensembl:ENSPPYP00000001010} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0018917 OC=Catarrhini; Hominidae; Pongo.
Sequence
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHAS
VAGHLSTSTTVSSSGAQNSDSTKKTLVTLIANNNAGNPLVQQGGQPLILTQNPAPGLGTM
VTQPVLRPVQVMQNANHVTSSPVASQPIFITTQGFPVRNVRPVQNAMNQVGIVLNVQQGQ
TVRPITLVPAPGTQFVKPTVGVPQVFSQMTPVRPGSTMPVRPTTNTFTTVIPATLTIRST
VPQSQSQQTKSTPSTSTTPTATQPTSLGQLAVQSPGQSNQTTNPKLAPSFPSPPAVSIAS
FVTVKRPGVTGENSNEVAKLVNTLNTIPSLGQSPGPVVVSNNSSAHGSQRTSGPESSMKV
TSSIPVFDLQDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVEYQKKGKSLDSEPSVPSA
AKPPSPEKTAPVASTPSSTPIPALSPPTKVPEPNENVGDAVQTKLIMLVDDFYYGRDGGK
VAQLTNFPKVATSFRCPHCTKRLKNNIRFMNHMKHHVELDQQNGEVDGHTICQHCYRQFS
TPFQLQCHLENVHSPYESTTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSS
LYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNAFQQHYMRHQKRNVYHCNKCRLQFLFAK
DKIEHKLQHHKTFRKPKQLEGLKPGTKVTIRASRGQPRTVPVSSNDTPPSALQEAAPLTS
SMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYST
CCSRAYANHMINNHVPRKSPKYLALFKNSVSGIKLACTSCTFVTSVGDAMAKHLVFNPSH
RSSSILPRGLTWIAHSRHGQTRDRGHDRNVKNMYPPLSFPTNKAATVKSAGATPAEPEEL
PTPLAPALPSPASTATPPPTPTHSQPSALPPLATEGAECLNVDDQDEGSPVTQEPEPASG
GGGSGGVGKKEQLSVKKLRVVLFALCCNTEQAAEHFRNPQRRIRRWLRRFQASQGENLEG
KYLSFEAEEKLAEWVLTQREQQLPVNEETLFQKATKIGRSLEGGFKISYEWAVRFMLRHH
LTPHARRAVAHTLPKDVAENAGLFIEFVQRQIHNQDLPLSMIVAIDEISLFLDTEVLSSD
DRKENALQTVGTGEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDSILLEAKESGYS
DDEIMELWSTRVWQKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSK
IQPLDVCIKRTVKNFLHKKWKEQAREMADTACDSDVLLQLVLVWLGEVLGVIGDCPELVQ
RSFLVASVLPGPDGNINSPTRNADMQEELIASLEEQLKLSGEHSESSTPRPRSSPEETVE
PESLHQLFEGESETESFYGFEEADLDLMEI
Download sequence
Identical sequences H2N5V5
ENSPPYP00000001010 9600.ENSPPYP00000001010 ENSPPYP00000001010 XP_009242683.1.23681 XP_009242688.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]