SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2N7W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2N7W6
Domain Number 1 Region: 68-264
Classification Level Classification E-value
Superfamily Rhomboid-like 3.27e-34
Family Rhomboid-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2N7W6
Sequence length 303
Comment (tr|H2N7W6|H2N7W6_PONAB) Rhomboid-like protein {ECO:0000256|RuleBase:RU362115} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0015604 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRG
TYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEKREEA
WRFISYMLVHAGVQHILGNLCMQLVLGIPLEMVHKGLRVGLVYLAGVIAGSLASSIFDPL
RYLVGASGGVYALMGGYFMNVLVNFQEMIPAFGIFRLLIIILIIVLDMGFALYRRFFVPE
DGSPVSFAAHIAGGFAGMSIGYTVFSCFDKALLKDPRFWIAIAAYLACVLFAVFFNIFLS
PAN
Download sequence
Identical sequences G3R248 H2N7W6 H2PYQ6 Q9NX52
ENSPPYP00000001748 ENSPPYP00000001748 ENSP00000289248 ENSP00000362081 9598.ENSPTRP00000000988 9600.ENSPPYP00000001748 9606.ENSP00000289248 ENSP00000289248 ENSP00000362081 gi|54144654|ref|NP_060291.2| NP_060291.2.87134 NP_060291.2.92137 XP_009250532.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]