SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2N817 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2N817
Domain Number 1 Region: 105-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.42e-16
Family TRASH domain 0.0036
Further Details:      
 
Domain Number 2 Region: 664-983,1059-1135
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000637
Family Hermes transposase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2N817
Sequence length 1172
Comment (tr|H2N817|H2N817_PONAB) Zinc finger MYM-type containing 1 {ECO:0000313|Ensembl:ENSPPYP00000001802} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=ZMYM1 OC=Catarrhini; Hominidae; Pongo.
Sequence
MPKLIGIWKLFFRKKPISLELENSFASDTKMKEPLLGGECDKAVASQLGLLDEIKTEPDN
AQEYCHRQQSRTQENELKINAVFSESASQLTAGIQLSLASSGMNKMLPSVSTTAIQVSCA
GCKKILQKGQTAYQRKGSAQLFCSIPCITEYISSASSPVPSKRTCSNCSKDILNPKDVIS
VQLEDTTSCKTFCSLSCLSSYEEKRKPFVTICTNSILTKCSMCQKTAIIQYEVKYQNVKH
NLCSNACLSKFHSANNFIMNCCENCGTYCYTSSSLSHILQTEGQSHYFNSSKSITAYKQK
PAKPLISVPCKPLKPSDEMIETTSDLGKTELFCSINCFSAYSKAKMESSSVNVVSVVHDT
STELLSPKKDTTPVISNIVSLADTDVALPIMNTDVLQDTVSSVTATADVIVDLSKSSPSE
PSSAVASSSMEQPSISPSSSVFSQHAIGSSIEVQKDNMKSMKISDELCHPKCTSKVQKVK
GKSRSIKKSCCADFECLENSKKDVAFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKF
RKHEKSEMHLKSLEFWREYQFCDGAVSDDLSIHSKQIEGNKKYLKLIIENILFLGKQCLP
LRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEML
QDIVNEINDSSAFSIICDETTNSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTEEMTG
THLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLRIKFNKIAAEFKKEEPRALYTHCYAHFL
DLSIIRFCKEVKELRSALKTLSSLFNTICMSGEMLANFRNICRLSQNKTCKKHISQSCWT
VHDRTLLSVIDSLPEIIETLEVIASHSSNTSFADELSHLLTLVSKFEFVFCLKFLYRVLS
VTGILSKELQNKTIDIFSLSSKIEAILECLSSERNDVYFKTIWDGTEEICQKITCKGFKV
EKPSLQKRRKIQKSVDLGNSDNMFFPTSTEEQYKINIYYQGLDTILQNLKLCFSEFDYCK
IKQISELLFKWNEPLNETTAKHVQEFYKLDEDIIPELRFYRHYAKLNFVIDDNCINFVSL
GCLFIQHGLHSNIPCLSKLLDIALSWPITSASTENSFSTLPRLKTYLCNTMGQEKLTGPA
LMAVEQELVNKLMEPERLNEIVEKFISQMKEI
Download sequence
Identical sequences H2N817
ENSPPYP00000001802 ENSPPYP00000001802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]