SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NA30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NA30
Domain Number 1 Region: 66-192
Classification Level Classification E-value
Superfamily Lysozyme-like 3.49e-47
Family C-type lysozyme 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NA30
Sequence length 195
Comment (tr|H2NA30|H2NA30_PONAB) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0044683 OC=Catarrhini; Hominidae; Pongo.
Sequence
MQDTHLSCLSPTKWSSVSSTDSTEKSASGAGTRNLPFQFCLRQALRMKAVGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRRGKLKENNYCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCE
GRDLSEWKKGCEVVS
Download sequence
Identical sequences H2NA30
ENSPPYP00000002539 ENSPPYP00000002539 9600.ENSPPYP00000002539 XP_002820673.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]