SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NCP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NCP1
Domain Number 1 Region: 187-532
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-86
Family Protein kinases, catalytic subunit 0.00000000000288
Further Details:      
 
Domain Number 2 Region: 30-184
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.58e-41
Family Regulator of G-protein signaling, RGS 0.0000000519
Further Details:      
 
Domain Number 3 Region: 554-664
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-27
Family Pleckstrin-homology domain (PH domain) 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NCP1
Sequence length 689
Comment (tr|H2NCP1|H2NCP1_PONAB) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0031520 OC=Catarrhini; Hominidae; Pongo.
Sequence
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLAC
SHPFSKSATEHVQGHLGKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARK
KAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKPRSPVVELSKVPLVQRGSANGL
Download sequence
Identical sequences A0A096N611 A0A0D9R809 A0A2K5L0Z3 A0A2K5QMM1 A0A2K6PMB5 H2NCP1 H9FQI5
9600.ENSPPYP00000003477 XP_002821498.1.23681 XP_007966817.1.81039 XP_010364666.1.97406 XP_011896875.1.92194 XP_017392853.1.71028 ENSPANP00000007898 ENSPPYP00000003477 ENSPPYP00000003477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]