SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NDK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NDK4
Domain Number 1 Region: 341-619
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.5e-87
Family Eukaryotic proteases 0.000000000307
Further Details:      
 
Domain Number 2 Region: 104-197
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-32
Family Kringle modules 0.000009
Further Details:      
 
Domain Number 3 Region: 210-297
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-27
Family Kringle modules 0.00000612
Further Details:      
 
Domain Number 4 Region: 45-105
Classification Level Classification E-value
Superfamily GLA-domain 1.55e-19
Family GLA-domain 0.0000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NDK4
Sequence length 623
Comment (tr|H2NDK4|H2NDK4_PONAB) Coagulation factor II {ECO:0000256|PIRNR:PIRNR001149} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0010932 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAHVRGLQLPGCLALAALCTLVHSQHVFLAPQQALSLLQRVRRANSVFLEEVRKGNLERE
CVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGH
LNITQSGIQCQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQ
ECSIPVCGQDQVTVAMTPRSEGSGVNLSPPSEQCVPDRGQQYQGRLAVTTHGLPCLAWAS
AQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAMEEET
GGGLDEDPDRAIEGRTATSEYQTFFDPRTFGSGEADCGLRPLFEKKSLEDKTERELLESY
IDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGATLISDRWVLTAAHCLLYPPWDKNFTE
NDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIH
PVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKVQPSVLQVVNLPIVERPVCKDS
TRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGK
YGFYTHVFRLKKWIQKVIDQFGE
Download sequence
Identical sequences H2NDK4
ENSPPYP00000003807 ENSPPYP00000003807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]