SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NDK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NDK6
Domain Number 1 Region: 473-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 382-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-17
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 3 Region: 524-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000171
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 4 Region: 569-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000578
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 343-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000142
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Weak hits

Sequence:  H2NDK6
Domain Number - Region: 456-475
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0602
Family Rad50 coiled-coil Zn hook 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NDK6
Sequence length 712
Comment (tr|H2NDK6|H2NDK6_PONAB) Zinc finger protein 408 {ECO:0000313|Ensembl:ENSPPYP00000003809} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=ZNF408 OC=Catarrhini; Hominidae; Pongo.
Sequence
MEEAEELLLEGKKALQPACEPRLGLDLGWNPSGEGCTQSLKDVPPGPTRAILALKSLPRG
LALGPSLAKEQRLGVWCVGNPLQPGLLWGPLEEESASKEKGEGVKPRQEENLSLGPWGDM
CACEQSSGWTSLVQRGRLESEGNMAPVRISERLHLQVYQLVLPGSELLLWPRPSSEGPSL
TQPGLDKEAAVEVVTEVESAVQQEVASPGEDAAEPCTDPGSQSPSGIQAENMVSPGLKFP
TQDRLSKDSQPLSPLLQDGDVDEEYPAQAQMPPELQSNLATQQDPDGSGATQPHGYMAKK
LHSPSDQCPPRAKTPEPGAQEPGCPTLLRSPPGPAKSSPKQGRRYRCGECGKAFLQLCHL
KKHAFVHTGHKPFLCTECGKSYSSEESFKAHMLGHRGVRPFPCSQCDKAYGTQRDLKEHQ
VVHSGARPFACDQCGKAFARRPSLRLHRKTHQVPAAPAPCPCPVCGRPLANQGSLRNHMR
LHTGEKPFLCPHCGRAFRQRGNLRGHLRLHTGERPYRCPHCADAFPQLPELRRHLISHTG
EAHLCPVCGKALRDPHTLRAHERLHSGERPFPCPQCGRAYTLATKLRRHLKSHLEDKPYR
CPTCGMGYTLPQSLRRHQLSHRPEAPCSPPSVPSAASEPTVVLLQAEPQLLDTHREEEVS
PTRDVVEVTISESQEKCFVVPEEPDAAPSLVLIHKDMGLGAWAEVVEVEMGT
Download sequence
Identical sequences H2NDK6
ENSPPYP00000003809 9600.ENSPPYP00000003809 ENSPPYP00000003809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]