SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2NE35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NE35
Domain Number 1 Region: 271-664
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000091
Family Hermes transposase-like 0.03
Further Details:      
 
Weak hits

Sequence:  H2NE35
Domain Number - Region: 121-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0476
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2NE35
Sequence length 693
Comment (tr|H2NE35|H2NE35_PONAB) Zinc finger BED-type containing 5 {ECO:0000313|Ensembl:ENSPPYP00000003999} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=ZBED5 OC=Catarrhini; Hominidae; Pongo.
Sequence
MIAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSES
NDQKVGILQSEDKQLQPSVSKKSEGELSRVKFISNSNKITFSKKPKRRKYDESYLSFGFT
YFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKP
PTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKKIDA
VQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRFNKS
IEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAVDGKIAEAVTLI
KYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMG
AQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADI
FTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINST
VDKDICSAIVQHLRGLHSTLLKYFPVTNDNNAWVRNPFTVTVKPASLVARDYESLIDLTS
DSQVKQNFSELSLNDFWSSLIQEYPSIARRAVRVLLPFATMHLCETGFSYYAATKTKYRK
RLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH
Download sequence
Identical sequences H2NE35
ENSPPYP00000003999 ENSPPYP00000003999 9600.ENSPPYP00000003999 XP_002822075.1.23681 XP_003777858.1.23681 XP_009244894.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]