SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2NG32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2NG32
Domain Number 1 Region: 80-398
Classification Level Classification E-value
Superfamily RNI-like 2.82e-42
Family 28-residue LRR 0.051
Further Details:      
 
Domain Number 2 Region: 3-48
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000017
Family F-box domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2NG32
Sequence length 418
Comment (tr|H2NG32|H2NG32_PONAB) F-box and leucine rich repeat protein 14 {ECO:0000313|Ensembl:ENSPPYP00000004718} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=FBXL14 OC=Catarrhini; Hominidae; Pongo.
Sequence
METHISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPS
LFPSLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLR
ALNLSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCR
HLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGG
ISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYI
AQGLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTG
IDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSSRR
Download sequence
Identical sequences A0A096MYM2 A0A2K5CDY1 A0A2K5I906 A0A2K5LF56 A0A2K5W802 A0A2K5XID7 F6R1C1 G1QQH0 H2NG32 K7BHJ2 Q8N1E6 U3F0B5
ENSMMUP00000025544 9544.ENSMMUP00000025544 9600.ENSPPYP00000004718 9606.ENSP00000344855 ENSNLEP00000003188 ENSMMUP00000025544 ENSP00000344855 ENSPPYP00000004718 NP_001247451.1.72884 NP_689654.1.87134 NP_689654.1.92137 XP_003733751.1.60252 XP_004092204.1.23891 XP_005569834.1.63531 XP_011786407.1.43180 XP_011822536.1.47321 XP_011909489.1.92194 XP_012331759.1.9421 XP_016778211.1.37143 gi|22748931|ref|NP_689654.1| ENSPPYP00000004718 ENSP00000344855 ENSP00000344855 ENSNLEP00000003188 NYSGRC-22748931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]